Icon representing a puzzle

2644: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 06, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,310
  2. Avatar for Go Science 2. Go Science 56 pts. 12,133
  3. Avatar for Contenders 3. Contenders 29 pts. 12,082
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 11,940
  5. Avatar for Australia 5. Australia 6 pts. 11,938
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 11,844
  7. Avatar for VeFold 7. VeFold 1 pt. 11,473
  8. Avatar for Team China 8. Team China 1 pt. 10,579
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 10,416
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,345
  1. Avatar for sftgfop1 51. sftgfop1 Lv 1 1 pt. 10,708
  2. Avatar for arotomic 52. arotomic Lv 1 1 pt. 10,701
  3. Avatar for haleyg 53. haleyg Lv 1 1 pt. 10,661
  4. Avatar for Trajan464 54. Trajan464 Lv 1 1 pt. 10,646
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 10,615
  6. Avatar for zo3xiaJonWeinberg 56. zo3xiaJonWeinberg Lv 1 1 pt. 10,579
  7. Avatar for jamiexq 57. jamiexq Lv 1 1 pt. 10,558
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 10,452
  9. Avatar for vuvuvu 59. vuvuvu Lv 1 1 pt. 10,416
  10. Avatar for jausmh 60. jausmh Lv 1 1 pt. 10,345

Comments