Placeholder image of a protein
Icon representing a puzzle

2654: Electron Density Reconstruction 133

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 39,363
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 35,885
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 32,019
  4. Avatar for BearCorp 14. BearCorp 1 pt. 31,515

  1. Avatar for spvincent 11. spvincent Lv 1 46 pts. 40,219
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 42 pts. 40,204
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 39 pts. 40,200
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 36 pts. 40,181
  5. Avatar for nicobul 15. nicobul Lv 1 33 pts. 40,015
  6. Avatar for Xendrais 16. Xendrais Lv 1 30 pts. 39,949
  7. Avatar for Anfinsen_slept_here 17. Anfinsen_slept_here Lv 1 27 pts. 39,916
  8. Avatar for meatexplosion 18. meatexplosion Lv 1 25 pts. 39,903
  9. Avatar for Zhang Ruichong 19. Zhang Ruichong Lv 1 23 pts. 39,771
  10. Avatar for jausmh 20. jausmh Lv 1 20 pts. 39,760

Comments