Placeholder image of a protein
Icon representing a puzzle

2654: Electron Density Reconstruction 133

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 39,363
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 35,885
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 32,019
  4. Avatar for BearCorp 14. BearCorp 1 pt. 31,515

  1. Avatar for alcor29 21. alcor29 Lv 1 19 pts. 39,697
  2. Avatar for georg137 22. georg137 Lv 1 17 pts. 39,578
  3. Avatar for Aarav_Awasthi 23. Aarav_Awasthi Lv 1 15 pts. 39,566
  4. Avatar for montezumasrevenge 24. montezumasrevenge Lv 1 14 pts. 39,566
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 12 pts. 39,540
  6. Avatar for dizzywings 26. dizzywings Lv 1 11 pts. 39,417
  7. Avatar for TheGUmmer 27. TheGUmmer Lv 1 10 pts. 39,363
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 9 pts. 39,334
  9. Avatar for SemperRabbit 29. SemperRabbit Lv 1 8 pts. 39,268
  10. Avatar for stomjoh 30. stomjoh Lv 1 7 pts. 39,265

Comments