Icon representing a puzzle

2653: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 27, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,499
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 9,577
  1. Avatar for Dr. Goochie 11. Dr. Goochie Lv 1 49 pts. 11,120
  2. Avatar for hookedwarm 12. hookedwarm Lv 1 46 pts. 11,119
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 42 pts. 11,119
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 39 pts. 11,085
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 36 pts. 11,048
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 33 pts. 10,984
  7. Avatar for SemperRabbit 17. SemperRabbit Lv 1 31 pts. 10,942
  8. Avatar for zxspectrum 18. zxspectrum Lv 1 28 pts. 10,931
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 26 pts. 10,921
  10. Avatar for Aubade01 20. Aubade01 Lv 1 24 pts. 10,915

Comments