Icon representing a puzzle

2653: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
August 27, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,499
  2. Avatar for GUGITBIOTECH 12. GUGITBIOTECH 1 pt. 9,577

  1. Avatar for ichwilldiesennamen 41. ichwilldiesennamen Lv 1 3 pts. 10,392
  2. Avatar for hada 42. hada Lv 1 2 pts. 10,384
  3. Avatar for Apothecary1815 43. Apothecary1815 Lv 1 2 pts. 10,361
  4. Avatar for Alistair69 44. Alistair69 Lv 1 2 pts. 10,306
  5. Avatar for Joanna_H 45. Joanna_H Lv 1 2 pts. 10,303
  6. Avatar for Crossed Sticks 46. Crossed Sticks Lv 1 2 pts. 10,288
  7. Avatar for Dr.Sillem 47. Dr.Sillem Lv 1 1 pt. 10,287
  8. Avatar for ProfVince 48. ProfVince Lv 1 1 pt. 10,228
  9. Avatar for Tian00 49. Tian00 Lv 1 1 pt. 10,096
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 10,090

Comments