Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,111
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,433
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 10,211
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,023
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 9,639
  7. Avatar for Firesign 17. Firesign 1 pt. 9,086
  1. Avatar for AlkiP0Ps 11. AlkiP0Ps Lv 1 50 pts. 11,366
  2. Avatar for Galaxie 12. Galaxie Lv 1 46 pts. 11,365
  3. Avatar for meatexplosion 13. meatexplosion Lv 1 43 pts. 11,344
  4. Avatar for bravosk8erboy 14. bravosk8erboy Lv 1 40 pts. 11,343
  5. Avatar for Dr. Goochie 15. Dr. Goochie Lv 1 37 pts. 11,339
  6. Avatar for BarrySampson 16. BarrySampson Lv 1 34 pts. 11,326
  7. Avatar for Zhang Ruichong 17. Zhang Ruichong Lv 1 31 pts. 11,311
  8. Avatar for akaaka 18. akaaka Lv 1 29 pts. 11,310
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 26 pts. 11,302
  10. Avatar for hookedwarm 20. hookedwarm Lv 1 24 pts. 11,278

Comments