Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,111
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,433
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 10,211
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,023
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 9,639
  7. Avatar for Firesign 17. Firesign 1 pt. 9,086

  1. Avatar for Anfinsen_slept_here 21. Anfinsen_slept_here Lv 1 22 pts. 11,276
  2. Avatar for Tehnologik1 22. Tehnologik1 Lv 1 20 pts. 11,268
  3. Avatar for TheGUmmer 23. TheGUmmer Lv 1 19 pts. 11,254
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 17 pts. 11,253
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 15 pts. 11,227
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 14 pts. 11,217
  7. Avatar for jausmh 27. jausmh Lv 1 13 pts. 11,138
  8. Avatar for Aarav_Awasthi 28. Aarav_Awasthi Lv 1 12 pts. 11,138
  9. Avatar for dizzywings 29. dizzywings Lv 1 11 pts. 11,111
  10. Avatar for alcor29 30. alcor29 Lv 1 10 pts. 11,110

Comments