Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,111
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,433
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 10,211
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,023
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 9,639
  7. Avatar for Firesign 17. Firesign 1 pt. 9,086
  1. Avatar for heather-1 31. heather-1 Lv 1 9 pts. 11,099
  2. Avatar for Dr.Sillem 32. Dr.Sillem Lv 1 8 pts. 11,091
  3. Avatar for zxspectrum 33. zxspectrum Lv 1 7 pts. 11,078
  4. Avatar for AlphaFold2 34. AlphaFold2 Lv 1 6 pts. 11,075
  5. Avatar for stomjoh 35. stomjoh Lv 1 6 pts. 11,070
  6. Avatar for ppp6 36. ppp6 Lv 1 5 pts. 11,003
  7. Avatar for pfirth 37. pfirth Lv 1 5 pts. 11,001
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 4 pts. 10,994
  9. Avatar for Larini 39. Larini Lv 1 4 pts. 10,982
  10. Avatar for hada 40. hada Lv 1 3 pts. 10,975

Comments