Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,111
  2. Avatar for Mahmut Oyunda 12. Mahmut Oyunda 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,433
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 10,211
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 10,023
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 9,639
  7. Avatar for Firesign 17. Firesign 1 pt. 9,086
  1. Avatar for piotrhalama 71. piotrhalama Lv 1 1 pt. 9,669
  2. Avatar for eweber 72. eweber Lv 1 1 pt. 9,639
  3. Avatar for gumster010 73. gumster010 Lv 1 1 pt. 9,322
  4. Avatar for aphil126 74. aphil126 Lv 1 1 pt. 9,086
  5. Avatar for lukesarcher03 75. lukesarcher03 Lv 1 1 pt. 9,086
  6. Avatar for NickDanger 76. NickDanger Lv 1 1 pt. 9,086
  7. Avatar for jdubz 77. jdubz Lv 1 1 pt. 9,086

Comments