Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,733
  2. Avatar for Go Science 2. Go Science 73 pts. 11,686
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,498
  4. Avatar for Contenders 4. Contenders 36 pts. 11,390
  5. Avatar for Australia 5. Australia 24 pts. 11,366
  6. Avatar for VeFold 6. VeFold 16 pts. 11,326
  7. Avatar for Team China 7. Team China 10 pts. 11,311
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 11,254
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 11,253
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,138
  1. Avatar for Fasodankfds 41. Fasodankfds Lv 1 3 pts. 10,953
  2. Avatar for jamiexq 42. jamiexq Lv 1 3 pts. 10,951
  3. Avatar for Crossed Sticks 43. Crossed Sticks Lv 1 2 pts. 10,919
  4. Avatar for Apothecary1815 44. Apothecary1815 Lv 1 2 pts. 10,914
  5. Avatar for ucad 45. ucad Lv 1 2 pts. 10,910
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 2 pts. 10,903
  7. Avatar for ProfVince 47. ProfVince Lv 1 1 pt. 10,893
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 10,885
  9. Avatar for Merf 49. Merf Lv 1 1 pt. 10,805
  10. Avatar for haleyg 50. haleyg Lv 1 1 pt. 10,803

Comments