Icon representing a puzzle

2656: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 03, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,733
  2. Avatar for Go Science 2. Go Science 73 pts. 11,686
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,498
  4. Avatar for Contenders 4. Contenders 36 pts. 11,390
  5. Avatar for Australia 5. Australia 24 pts. 11,366
  6. Avatar for VeFold 6. VeFold 16 pts. 11,326
  7. Avatar for Team China 7. Team China 10 pts. 11,311
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 11,254
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 11,253
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 11,138
  1. Avatar for RWoodcock 61. RWoodcock Lv 1 1 pt. 10,423
  2. Avatar for ZiiONIC 62. ZiiONIC Lv 1 1 pt. 10,417
  3. Avatar for dreamakers 63. dreamakers Lv 1 1 pt. 10,380
  4. Avatar for rinze 64. rinze Lv 1 1 pt. 10,376
  5. Avatar for antibot215 65. antibot215 Lv 1 1 pt. 10,358
  6. Avatar for ScratchKid 66. ScratchKid Lv 1 1 pt. 10,341
  7. Avatar for efull 67. efull Lv 1 1 pt. 10,326
  8. Avatar for foldit.expert 68. foldit.expert Lv 1 1 pt. 10,211
  9. Avatar for andrewgood 69. andrewgood Lv 1 1 pt. 10,211
  10. Avatar for Savas 70. Savas Lv 1 1 pt. 10,023

Comments