Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,079
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,916
  3. Avatar for Mahmut Oyunda 13. Mahmut Oyunda 1 pt. 10,407
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,195
  1. Avatar for Xendrais 21. Xendrais Lv 1 22 pts. 11,354
  2. Avatar for SemperRabbit 22. SemperRabbit Lv 1 20 pts. 11,350
  3. Avatar for georg137 23. georg137 Lv 1 19 pts. 11,332
  4. Avatar for BarrySampson 24. BarrySampson Lv 1 17 pts. 11,311
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 15 pts. 11,274
  6. Avatar for TheGUmmer 26. TheGUmmer Lv 1 14 pts. 11,208
  7. Avatar for heather-1 27. heather-1 Lv 1 13 pts. 11,201
  8. Avatar for hookedwarm 28. hookedwarm Lv 1 12 pts. 11,105
  9. Avatar for jausmh 29. jausmh Lv 1 11 pts. 11,102
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 10 pts. 11,079

Comments