2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 6 months ago

Summary

• Created: September 10, 2025
• Expires: September 17, 2025 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

• Sequence: GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

• 1. Anthropic Dreams 100 pts. 12,011
• 2. Go Science 68 pts. 11,937
• 3. L'Alliance Francophone 44 pts. 11,561
• 4. Team China 27 pts. 11,522
• 5. FamilyBarmettler 16 pts. 11,444
• 6. Contenders 9 pts. 11,391
• 7. VeFold 5 pts. 11,311
• 8. Australia 3 pts. 11,274
• 9. Void Crushers 1 pt. 11,208
• 10. Marvin's bunch 1 pt. 11,102

Top soloists

• 1. LociOiling 100 pts. 12,011
• 2. Serca 94 pts. 11,937
• 3. ichwilldiesennamen 88 pts. 11,864
• 4. grogar7 82 pts. 11,696
• 5. Bruno Kestemont 77 pts. 11,609
• 6. bravosk8erboy 72 pts. 11,599
• 7. nicobul 67 pts. 11,561
• 8. Galaxie 62 pts. 11,556
• 9. gmn 58 pts. 11,550
• 10. Aarav_Awasthi 54 pts. 11,545

Comments

[LociOiling]

lucky 13: https://foldit.fandom.com/wiki/Revisiting_puzzle/153:_Rosetta_Decoy_13