Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,011
  2. Avatar for Go Science 2. Go Science 68 pts. 11,937
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 11,561
  4. Avatar for Team China 4. Team China 27 pts. 11,522
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 11,444
  6. Avatar for Contenders 6. Contenders 9 pts. 11,391
  7. Avatar for VeFold 7. VeFold 5 pts. 11,311
  8. Avatar for Australia 8. Australia 3 pts. 11,274
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 11,208
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 11,102

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,011
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 11,937
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 88 pts. 11,864
  4. Avatar for grogar7 4. grogar7 Lv 1 82 pts. 11,696
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 77 pts. 11,609
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 72 pts. 11,599
  7. Avatar for nicobul 7. nicobul Lv 1 67 pts. 11,561
  8. Avatar for Galaxie 8. Galaxie Lv 1 62 pts. 11,556
  9. Avatar for gmn 9. gmn Lv 1 58 pts. 11,550
  10. Avatar for Aarav_Awasthi 10. Aarav_Awasthi Lv 1 54 pts. 11,545

Comments