Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,079
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,916
  3. Avatar for Mahmut Oyunda 13. Mahmut Oyunda 1 pt. 10,407
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,195
  1. Avatar for alcor29 31. alcor29 Lv 1 9 pts. 11,062
  2. Avatar for zxspectrum 32. zxspectrum Lv 1 8 pts. 10,999
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 7 pts. 10,995
  4. Avatar for dizzywings 34. dizzywings Lv 1 6 pts. 10,951
  5. Avatar for aendgraend 35. aendgraend Lv 1 6 pts. 10,916
  6. Avatar for borattt 36. borattt Lv 1 5 pts. 10,875
  7. Avatar for Dr.Sillem 37. Dr.Sillem Lv 1 5 pts. 10,838
  8. Avatar for montezumasrevenge 38. montezumasrevenge Lv 1 4 pts. 10,837
  9. Avatar for ProfVince 39. ProfVince Lv 1 4 pts. 10,788
  10. Avatar for Anfinsen_slept_here 40. Anfinsen_slept_here Lv 1 3 pts. 10,734

Comments