Icon representing a puzzle

2659: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
September 10, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 11,079
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 10,916
  3. Avatar for Mahmut Oyunda 13. Mahmut Oyunda 1 pt. 10,407
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,195
  1. Avatar for Bletchley Park 71. Bletchley Park Lv 1 1 pt. 8,295
  2. Avatar for david persian 72. david persian Lv 1 1 pt. 8,295
  3. Avatar for Anant Bhai 73. Anant Bhai Lv 1 1 pt. 8,295
  4. Avatar for zqzqzq 74. zqzqzq Lv 1 1 pt. 8,295
  5. Avatar for samuel040701 75. samuel040701 Lv 1 1 pt. 8,295
  6. Avatar for hacek 76. hacek Lv 1 1 pt. 8,295
  7. Avatar for Willjrod 77. Willjrod Lv 1 1 pt. 8,295

Comments