Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,800
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,667
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,441
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,262
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,690
  1. Avatar for Anfinsen_slept_here 11. Anfinsen_slept_here Lv 1 47 pts. 11,501
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 44 pts. 11,499
  3. Avatar for g_b 13. g_b Lv 1 40 pts. 11,482
  4. Avatar for Aarav_Awasthi 14. Aarav_Awasthi Lv 1 37 pts. 11,469
  5. Avatar for nicobul 15. nicobul Lv 1 34 pts. 11,446
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 31 pts. 11,437
  7. Avatar for gmn 17. gmn Lv 1 28 pts. 11,428
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 26 pts. 11,395
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 24 pts. 11,340
  10. Avatar for TheGUmmer 20. TheGUmmer Lv 1 22 pts. 11,333

Comments