Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,800
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,667
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,441
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,262
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,690

  1. Avatar for georg137 21. georg137 Lv 1 20 pts. 11,300
  2. Avatar for meatexplosion 22. meatexplosion Lv 1 18 pts. 11,252
  3. Avatar for zxspectrum 23. zxspectrum Lv 1 16 pts. 11,218
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 15 pts. 11,214
  5. Avatar for Galaxie 25. Galaxie Lv 1 13 pts. 11,172
  6. Avatar for SemperRabbit 26. SemperRabbit Lv 1 12 pts. 11,152
  7. Avatar for BarrySampson 27. BarrySampson Lv 1 11 pts. 11,147
  8. Avatar for jausmh 28. jausmh Lv 1 10 pts. 11,058
  9. Avatar for heather-1 29. heather-1 Lv 1 9 pts. 11,037
  10. Avatar for montezumasrevenge 30. montezumasrevenge Lv 1 8 pts. 11,017

Comments