Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,800
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,667
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,441
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,262
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,690
  1. Avatar for hookedwarm 31. hookedwarm Lv 1 7 pts. 10,975
  2. Avatar for manu8170 32. manu8170 Lv 1 6 pts. 10,947
  3. Avatar for Zhang Ruichong 33. Zhang Ruichong Lv 1 6 pts. 10,850
  4. Avatar for Idiotboy 34. Idiotboy Lv 1 5 pts. 10,822
  5. Avatar for aendgraend 35. aendgraend Lv 1 4 pts. 10,800
  6. Avatar for alcor29 36. alcor29 Lv 1 4 pts. 10,763
  7. Avatar for dizzywings 37. dizzywings Lv 1 3 pts. 10,667
  8. Avatar for Trajan464 38. Trajan464 Lv 1 3 pts. 10,610
  9. Avatar for Dr.Sillem 39. Dr.Sillem Lv 1 3 pts. 10,591
  10. Avatar for hada 40. hada Lv 1 2 pts. 10,564

Comments