Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,800
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,667
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,441
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,262
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,690
  1. Avatar for Laudrup18 51. Laudrup18 Lv 1 1 pt. 10,226
  2. Avatar for Tehnologik1 52. Tehnologik1 Lv 1 1 pt. 10,218
  3. Avatar for Fasodankfds 53. Fasodankfds Lv 1 1 pt. 10,180
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 10,159
  5. Avatar for Merf 55. Merf Lv 1 1 pt. 10,112
  6. Avatar for Hellcat6 56. Hellcat6 Lv 1 1 pt. 10,094
  7. Avatar for Mohoernchen 57. Mohoernchen Lv 1 1 pt. 10,007
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,935
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 9,912
  10. Avatar for Scopper 60. Scopper Lv 1 1 pt. 9,851

Comments