Icon representing a puzzle

2662: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
September 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,800
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,667
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,441
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,262
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,690

  1. Avatar for antibot215 61. antibot215 Lv 1 1 pt. 9,843
  2. Avatar for efull 62. efull Lv 1 1 pt. 9,834
  3. Avatar for Jeuxdit<3 63. Jeuxdit<3 Lv 1 1 pt. 9,739
  4. Avatar for EvalynJR 64. EvalynJR Lv 1 1 pt. 9,716
  5. Avatar for Tkzw-shieu 65. Tkzw-shieu Lv 1 1 pt. 9,702
  6. Avatar for nabwio 66. nabwio Lv 1 1 pt. 9,698
  7. Avatar for Sammy3c2b1a0 67. Sammy3c2b1a0 Lv 1 1 pt. 9,690
  8. Avatar for apetrides 68. apetrides Lv 1 1 pt. 9,685
  9. Avatar for oxplough 69. oxplough Lv 1 1 pt. 9,677
  10. Avatar for Sunflower 70. Sunflower Lv 1 1 pt. 9,629

Comments