Icon representing a puzzle

2665: Revisiting Puzzle 165: Rosetta Model 15

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
September 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 12,019
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,010
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 11,453
  4. Avatar for Contenders 4. Contenders 41 pts. 11,401
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 11,301
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 20 pts. 11,287
  7. Avatar for Australia 7. Australia 14 pts. 11,227
  8. Avatar for VeFold 8. VeFold 9 pts. 11,221
  9. Avatar for Marvin's bunch 9. Marvin's bunch 6 pts. 11,176
  10. Avatar for Team China 10. Team China 4 pts. 11,134

  1. Avatar for georg137 11. georg137 Lv 1 51 pts. 11,401
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 48 pts. 11,373
  3. Avatar for meatexplosion 13. meatexplosion Lv 1 44 pts. 11,316
  4. Avatar for Xendrais 14. Xendrais Lv 1 41 pts. 11,315
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 38 pts. 11,305
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 35 pts. 11,301
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 33 pts. 11,287
  8. Avatar for Galaxie 18. Galaxie Lv 1 30 pts. 11,243
  9. Avatar for SemperRabbit 19. SemperRabbit Lv 1 28 pts. 11,235
  10. Avatar for AlkiP0Ps 20. AlkiP0Ps Lv 1 26 pts. 11,227

Comments