Icon representing a puzzle

2665: Revisiting Puzzle 165: Rosetta Model 15

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
September 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 12,019
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,010
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 11,453
  4. Avatar for Contenders 4. Contenders 41 pts. 11,401
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 11,301
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 20 pts. 11,287
  7. Avatar for Australia 7. Australia 14 pts. 11,227
  8. Avatar for VeFold 8. VeFold 9 pts. 11,221
  9. Avatar for Marvin's bunch 9. Marvin's bunch 6 pts. 11,176
  10. Avatar for Team China 10. Team China 4 pts. 11,134

  1. Avatar for BarrySampson 21. BarrySampson Lv 1 24 pts. 11,221
  2. Avatar for montezumasrevenge 22. montezumasrevenge Lv 1 22 pts. 11,197
  3. Avatar for orily1337 23. orily1337 Lv 1 20 pts. 11,176
  4. Avatar for g_b 24. g_b Lv 1 18 pts. 11,174
  5. Avatar for gmn 25. gmn Lv 1 17 pts. 11,167
  6. Avatar for Zhang Ruichong 26. Zhang Ruichong Lv 1 15 pts. 11,134
  7. Avatar for hookedwarm 27. hookedwarm Lv 1 14 pts. 11,100
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 13 pts. 11,076
  9. Avatar for dizzywings 29. dizzywings Lv 1 12 pts. 11,070
  10. Avatar for nicobul 30. nicobul Lv 1 11 pts. 11,056

Comments