Icon representing a puzzle

2665: Revisiting Puzzle 165: Rosetta Model 15

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
September 24, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 12,019
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 12,010
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 11,453
  4. Avatar for Contenders 4. Contenders 41 pts. 11,401
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 11,301
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 20 pts. 11,287
  7. Avatar for Australia 7. Australia 14 pts. 11,227
  8. Avatar for VeFold 8. VeFold 9 pts. 11,221
  9. Avatar for Marvin's bunch 9. Marvin's bunch 6 pts. 11,176
  10. Avatar for Team China 10. Team China 4 pts. 11,134

  1. Avatar for hada 41. hada Lv 1 3 pts. 10,752
  2. Avatar for zbp 42. zbp Lv 1 3 pts. 10,677
  3. Avatar for ProfVince 43. ProfVince Lv 1 3 pts. 10,670
  4. Avatar for jamiexq 44. jamiexq Lv 1 2 pts. 10,646
  5. Avatar for Steven Pletsch 45. Steven Pletsch Lv 1 2 pts. 10,603
  6. Avatar for Gerom 46. Gerom Lv 1 2 pts. 10,573
  7. Avatar for Merf 47. Merf Lv 1 2 pts. 10,551
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 2 pts. 10,546
  9. Avatar for Hellcat6 49. Hellcat6 Lv 1 1 pt. 10,534
  10. Avatar for Will the pill 50. Will the pill Lv 1 1 pt. 10,521

Comments