Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974

  1. Avatar for zxspectrum 21. zxspectrum Lv 1 25 pts. 11,241
  2. Avatar for Zhang Ruichong 22. Zhang Ruichong Lv 1 23 pts. 11,158
  3. Avatar for akaaka 23. akaaka Lv 1 21 pts. 11,091
  4. Avatar for georg137 24. georg137 Lv 1 19 pts. 11,072
  5. Avatar for orily1337 25. orily1337 Lv 1 18 pts. 11,046
  6. Avatar for alcor29 26. alcor29 Lv 1 16 pts. 10,995
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 15 pts. 10,979
  8. Avatar for Apothecary1815 28. Apothecary1815 Lv 1 14 pts. 10,974
  9. Avatar for aendgraend 29. aendgraend Lv 1 12 pts. 10,974
  10. Avatar for Dr.Sillem 30. Dr.Sillem Lv 1 11 pts. 10,949

Comments