Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,687
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 94 pts. 11,640
  3. Avatar for Dr. Goochie 3. Dr. Goochie Lv 1 89 pts. 11,586
  4. Avatar for WBarme1234 4. WBarme1234 Lv 1 83 pts. 11,579
  5. Avatar for Serca 5. Serca Lv 1 78 pts. 11,558
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 73 pts. 11,547
  7. Avatar for Aubade01 7. Aubade01 Lv 1 69 pts. 11,491
  8. Avatar for SemperRabbit 8. SemperRabbit Lv 1 64 pts. 11,484
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 60 pts. 11,418
  10. Avatar for grogar7 10. grogar7 Lv 1 56 pts. 11,410

Comments