Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974

  1. Avatar for ZiiONIC 51. ZiiONIC Lv 1 1 pt. 10,317
  2. Avatar for mammillaria 52. mammillaria Lv 1 1 pt. 10,281
  3. Avatar for Steven Pletsch 53. Steven Pletsch Lv 1 1 pt. 10,278
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 10,233
  5. Avatar for Laudrup18 55. Laudrup18 Lv 1 1 pt. 10,191
  6. Avatar for SirMustache 56. SirMustache Lv 1 1 pt. 10,139
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 10,081
  8. Avatar for sdjf 58. sdjf Lv 1 1 pt. 10,052
  9. Avatar for DScott 59. DScott Lv 1 1 pt. 9,974
  10. Avatar for thewholeblahthing 60. thewholeblahthing Lv 1 1 pt. 9,971

Comments