Placeholder image of a protein
Icon representing a puzzle

2672b: Electron Density Reconstruction 139

Closed since 6 months ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
October 09, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MRLLSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 46,287
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 30,412
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 25,660
  4. Avatar for BIOL2020AB Fall2025 14. BIOL2020AB Fall2025 1 pt. 6,683

  1. Avatar for ichwilldiesennamen 100 pts. 52,224
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 52,126
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 52,124
  4. Avatar for Xendrais 4. Xendrais Lv 1 81 pts. 51,552
  5. Avatar for Galaxie 5. Galaxie Lv 1 75 pts. 51,400
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 70 pts. 51,250
  7. Avatar for Aarav_Awasthi 7. Aarav_Awasthi Lv 1 65 pts. 51,127
  8. Avatar for spvincent 8. spvincent Lv 1 60 pts. 51,084
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 56 pts. 51,019
  10. Avatar for nicobul 10. nicobul Lv 1 51 pts. 50,859

Comments


LociOiling Lv 1

Much like the fatally flawed 2672, this puzzle is a match for PDB 1XA6. The experiment for 1XA6 ended up with a long section of missing residues in the middle of the chain. As a result, Foldit recipes see two chains, one before the gap and one after the gap.

In 2672b, the sides of the gap are not connected, so there's no puckering.

bravosk8erboy Lv 1

for comparing the Amino acid differences we have 2 main matches and 2 extra additions
for PDB 1XA6 we have
"mrllsslsgssvssdaeeyq"
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"ekvsrrlsrskneprktnvtheehtavekisslvrraalthndnhfn"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"

for Fold.it we have
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"