Placeholder image of a protein
Icon representing a puzzle

2672b: Electron Density Reconstruction 139

Closed since 5 months ago

Novice Overall Prediction Electron Density

Summary

Created
October 09, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MRLLSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 52,224
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 52,151
  3. Avatar for Contenders 3. Contenders 44 pts. 51,582
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 51,250
  5. Avatar for Australia 5. Australia 16 pts. 50,358
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 49,579
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 49,429
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 48,591
  9. Avatar for VeFold 9. VeFold 1 pt. 48,568
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 47,775
  1. Avatar for ichwilldiesennamen
    1. ichwilldiesennamen Lv 1
    100 pts. 52,224
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 52,126
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 52,124
  4. Avatar for Xendrais 4. Xendrais Lv 1 81 pts. 51,552
  5. Avatar for Galaxie 5. Galaxie Lv 1 75 pts. 51,400
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 70 pts. 51,250
  7. Avatar for Aarav_Awasthi 7. Aarav_Awasthi Lv 1 65 pts. 51,127
  8. Avatar for spvincent 8. spvincent Lv 1 60 pts. 51,084
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 56 pts. 51,019
  10. Avatar for nicobul 10. nicobul Lv 1 51 pts. 50,859

Comments

LociOiling Lv 1

Much like the fatally flawed 2672, this puzzle is a match for PDB 1XA6. The experiment for 1XA6 ended up with a long section of missing residues in the middle of the chain. As a result, Foldit recipes see two chains, one before the gap and one after the gap.

In 2672b, the sides of the gap are not connected, so there's no puckering.

bravosk8erboy Lv 1

for comparing the Amino acid differences we have 2 main matches and 2 extra additions
for PDB 1XA6 we have
"mrllsslsgssvssdaeeyq"
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"ekvsrrlsrskneprktnvtheehtavekisslvrraalthndnhfn"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"

for Fold.it we have
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"