beta_helix Staff Lv 1
This is a repost of 2672 which was missing a break in the chain.
Closed since 6 months ago
Novice Overall Prediction Electron DensityThe structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.
This is a repost of 2672 which was missing a break in the chain.
Thanks for a quick correction of it
Much like the fatally flawed 2672, this puzzle is a match for PDB 1XA6. The experiment for 1XA6 ended up with a long section of missing residues in the middle of the chain. As a result, Foldit recipes see two chains, one before the gap and one after the gap.
In 2672b, the sides of the gap are not connected, so there's no puckering.
for comparing the Amino acid differences we have 2 main matches and 2 extra additions
for PDB 1XA6 we have
"mrllsslsgssvssdaeeyq"
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"ekvsrrlsrskneprktnvtheehtavekisslvrraalthndnhfn"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"
for Fold.it we have
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"
i think it's going to be
offset -19 length 141
offset -207 length 258
@beta_helix the in game sequence doesn't match the sequence on this page. see my above post for the correct in game sequence.