Placeholder image of a protein
Icon representing a puzzle

2672b: Electron Density Reconstruction 139

Closed since 5 months ago

Novice Overall Prediction Electron Density

Summary


Created
October 09, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MRLLSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 46,287
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 30,412
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 25,660
  4. Avatar for BIOL2020AB Fall2025 14. BIOL2020AB Fall2025 1 pt. 6,683

  1. Avatar for meatexplosion 21. meatexplosion Lv 1 20 pts. 49,509
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 18 pts. 49,487
  3. Avatar for dizzywings 23. dizzywings Lv 1 16 pts. 49,429
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 15 pts. 49,305
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 13 pts. 49,298
  6. Avatar for georg137 26. georg137 Lv 1 12 pts. 48,825
  7. Avatar for TheGUmmer 27. TheGUmmer Lv 1 11 pts. 48,591
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 10 pts. 48,568
  9. Avatar for Steven Pletsch 29. Steven Pletsch Lv 1 9 pts. 48,546
  10. Avatar for Trajan464 30. Trajan464 Lv 1 8 pts. 48,168

Comments


LociOiling Lv 1

Much like the fatally flawed 2672, this puzzle is a match for PDB 1XA6. The experiment for 1XA6 ended up with a long section of missing residues in the middle of the chain. As a result, Foldit recipes see two chains, one before the gap and one after the gap.

In 2672b, the sides of the gap are not connected, so there's no puckering.

bravosk8erboy Lv 1

for comparing the Amino acid differences we have 2 main matches and 2 extra additions
for PDB 1XA6 we have
"mrllsslsgssvssdaeeyq"
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"ekvsrrlsrskneprktnvtheehtavekisslvrraalthndnhfn"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"

for Fold.it we have
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"