Placeholder image of a protein
Icon representing a puzzle

2672b: Electron Density Reconstruction 139

Closed since 5 months ago

Novice Overall Prediction Electron Density

Summary

Created
October 09, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MRLLSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 46,287
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 30,412
  3. Avatar for Antharis Therapeutics 13. Antharis Therapeutics 1 pt. 25,660
  4. Avatar for BIOL2020AB Fall2025 14. BIOL2020AB Fall2025 1 pt. 6,683
  1. Avatar for neare2330 71. neare2330 Lv 1 1 pt. 6,683
  2. Avatar for antibot215 72. antibot215 Lv 1 1 pt. 6,683

Comments

LociOiling Lv 1

Much like the fatally flawed 2672, this puzzle is a match for PDB 1XA6. The experiment for 1XA6 ended up with a long section of missing residues in the middle of the chain. As a result, Foldit recipes see two chains, one before the gap and one after the gap.

In 2672b, the sides of the gap are not connected, so there's no puckering.

bravosk8erboy Lv 1

for comparing the Amino acid differences we have 2 main matches and 2 extra additions
for PDB 1XA6 we have
"mrllsslsgssvssdaeeyq"
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"ekvsrrlsrskneprktnvtheehtavekisslvrraalthndnhfn"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"

for Fold.it we have
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"