Placeholder image of a protein
Icon representing a puzzle

2672b: Electron Density Reconstruction 139

Closed since 5 months ago

Novice Overall Prediction Electron Density

Summary

Created
October 09, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MRLLSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 52,224
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 52,151
  3. Avatar for Contenders 3. Contenders 44 pts. 51,582
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 51,250
  5. Avatar for Australia 5. Australia 16 pts. 50,358
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 49,579
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 49,429
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 48,591
  9. Avatar for VeFold 9. VeFold 1 pt. 48,568
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 47,775
  1. Avatar for zxspectrum 31. zxspectrum Lv 1 7 pts. 48,114
  2. Avatar for jausmh 32. jausmh Lv 1 6 pts. 47,775
  3. Avatar for Zhang Ruichong 33. Zhang Ruichong Lv 1 6 pts. 47,632
  4. Avatar for ucad 34. ucad Lv 1 5 pts. 47,083
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 4 pts. 47,073
  6. Avatar for hada 36. hada Lv 1 4 pts. 47,067
  7. Avatar for manu8170 37. manu8170 Lv 1 3 pts. 46,899
  8. Avatar for alcor29 38. alcor29 Lv 1 3 pts. 46,795
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 3 pts. 46,632
  10. Avatar for SileNTViP 40. SileNTViP Lv 1 2 pts. 46,314

Comments

LociOiling Lv 1

Much like the fatally flawed 2672, this puzzle is a match for PDB 1XA6. The experiment for 1XA6 ended up with a long section of missing residues in the middle of the chain. As a result, Foldit recipes see two chains, one before the gap and one after the gap.

In 2672b, the sides of the gap are not connected, so there's no puckering.

bravosk8erboy Lv 1

for comparing the Amino acid differences we have 2 main matches and 2 extra additions
for PDB 1XA6 we have
"mrllsslsgssvssdaeeyq"
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"ekvsrrlsrskneprktnvtheehtavekisslvrraalthndnhfn"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"

for Fold.it we have
"ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaaeyiskmttnpiyehigyatllr"
"yekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf"