Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 7,736
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0

  1. Avatar for AlkiP0Ps 21. AlkiP0Ps Lv 1 24 pts. 10,217
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 22 pts. 10,199
  3. Avatar for bravosk8erboy 23. bravosk8erboy Lv 1 21 pts. 10,152
  4. Avatar for BarrySampson 24. BarrySampson Lv 1 19 pts. 10,134
  5. Avatar for Zhang Ruichong 25. Zhang Ruichong Lv 1 17 pts. 10,107
  6. Avatar for heather-1 26. heather-1 Lv 1 16 pts. 10,087
  7. Avatar for Elfi 27. Elfi Lv 1 15 pts. 10,073
  8. Avatar for Joanna_H 28. Joanna_H Lv 1 13 pts. 10,020
  9. Avatar for georg137 29. georg137 Lv 1 12 pts. 9,906
  10. Avatar for Dr.Sillem 30. Dr.Sillem Lv 1 11 pts. 9,806

Comments