Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 7,736
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0

  1. Avatar for pfirth 31. pfirth Lv 1 10 pts. 9,781
  2. Avatar for zxspectrum 32. zxspectrum Lv 1 9 pts. 9,754
  3. Avatar for Aarav_Awasthi 33. Aarav_Awasthi Lv 1 8 pts. 9,751
  4. Avatar for Merf 34. Merf Lv 1 7 pts. 9,673
  5. Avatar for westchuck 35. westchuck Lv 1 7 pts. 9,653
  6. Avatar for Alistair69 36. Alistair69 Lv 1 6 pts. 9,636
  7. Avatar for abiogenesis 37. abiogenesis Lv 1 6 pts. 9,591
  8. Avatar for alcor29 38. alcor29 Lv 1 5 pts. 9,584
  9. Avatar for Jenot96 39. Jenot96 Lv 1 4 pts. 9,501
  10. Avatar for rosie4loop 40. rosie4loop Lv 1 4 pts. 9,453

Comments