Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 7,736
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0

  1. Avatar for bestfolder29zb 51. bestfolder29zb Lv 1 1 pt. 8,678
  2. Avatar for hada 52. hada Lv 1 1 pt. 8,556
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 8,543
  4. Avatar for Larini 54. Larini Lv 1 1 pt. 8,524
  5. Avatar for RWoodcock 55. RWoodcock Lv 1 1 pt. 8,473
  6. Avatar for tigerlucifer 56. tigerlucifer Lv 1 1 pt. 8,420
  7. Avatar for mammillaria 57. mammillaria Lv 1 1 pt. 8,399
  8. Avatar for niurunfolds 58. niurunfolds Lv 1 1 pt. 8,379
  9. Avatar for fact0rial 59. fact0rial Lv 1 1 pt. 8,155
  10. Avatar for Tian00 60. Tian00 Lv 1 1 pt. 7,992

Comments