Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 7,736
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for Orbiz 71. Orbiz Lv 1 1 pt. 7,399
  2. Avatar for evifnoskcaj 72. evifnoskcaj Lv 1 1 pt. 6,976
  3. Avatar for prkfour 73. prkfour Lv 1 1 pt. 6,828
  4. Avatar for Esteban C 74. Esteban C Lv 1 1 pt. 6,150
  5. Avatar for Liz_b 75. Liz_b Lv 1 1 pt. 4,537
  6. Avatar for ict_nsau 76. ict_nsau Lv 1 1 pt. 0
  7. Avatar for w1w1w 77. w1w1w Lv 1 1 pt. 0
  8. Avatar for GLauster 78. GLauster Lv 1 1 pt. 0
  9. Avatar for rmoretti 79. rmoretti Lv 1 1 pt. 0
  10. Avatar for meatexplosion 80. meatexplosion Lv 1 1 pt. 0

Comments