Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,761
  2. Avatar for Go Science 2. Go Science 63 pts. 10,748
  3. Avatar for VeFold 3. VeFold 37 pts. 10,607
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,421
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 10,359
  6. Avatar for Contenders 6. Contenders 5 pts. 10,284
  7. Avatar for Australia 7. Australia 2 pts. 10,217
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,199
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,020
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,119
  1. Avatar for nicobul 11. nicobul Lv 1 52 pts. 10,421
  2. Avatar for gmn 12. gmn Lv 1 48 pts. 10,412
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 45 pts. 10,359
  4. Avatar for g_b 14. g_b Lv 1 42 pts. 10,347
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 39 pts. 10,325
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 36 pts. 10,318
  7. Avatar for Apothecary1815 17. Apothecary1815 Lv 1 33 pts. 10,309
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 31 pts. 10,284
  9. Avatar for akaaka 19. akaaka Lv 1 28 pts. 10,253
  10. Avatar for Anfinsen_slept_here 20. Anfinsen_slept_here Lv 1 26 pts. 10,245

Comments