Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,761
  2. Avatar for Go Science 2. Go Science 63 pts. 10,748
  3. Avatar for VeFold 3. VeFold 37 pts. 10,607
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,421
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 10,359
  6. Avatar for Contenders 6. Contenders 5 pts. 10,284
  7. Avatar for Australia 7. Australia 2 pts. 10,217
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,199
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,020
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,119
  1. Avatar for zbp 41. zbp Lv 1 4 pts. 9,420
  2. Avatar for Hellcat6 42. Hellcat6 Lv 1 3 pts. 9,339
  3. Avatar for SileNTViP 43. SileNTViP Lv 1 3 pts. 9,335
  4. Avatar for carxo 44. carxo Lv 1 3 pts. 9,281
  5. Avatar for dahast.de 45. dahast.de Lv 1 2 pts. 9,119
  6. Avatar for ucad 46. ucad Lv 1 2 pts. 9,066
  7. Avatar for ZiiONIC 47. ZiiONIC Lv 1 2 pts. 9,059
  8. Avatar for Moolanie 48. Moolanie Lv 1 2 pts. 9,054
  9. Avatar for Greg60 49. Greg60 Lv 1 2 pts. 8,984
  10. Avatar for Mohoernchen 50. Mohoernchen Lv 1 1 pt. 8,858

Comments