Icon representing a puzzle

2677: Revisiting Puzzle 55: Scorpion Toxin

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 22, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,761
  2. Avatar for Go Science 2. Go Science 63 pts. 10,748
  3. Avatar for VeFold 3. VeFold 37 pts. 10,607
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,421
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 10,359
  6. Avatar for Contenders 6. Contenders 5 pts. 10,284
  7. Avatar for Australia 7. Australia 2 pts. 10,217
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,199
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,020
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,119
  1. Avatar for bingxi@2085 61. bingxi@2085 Lv 1 1 pt. 7,783
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 7,779
  3. Avatar for borattt 63. borattt Lv 1 1 pt. 7,769
  4. Avatar for tamai 64. tamai Lv 1 1 pt. 7,754
  5. Avatar for HelpME 65. HelpME Lv 1 1 pt. 7,736
  6. Avatar for Arlind1 66. Arlind1 Lv 1 1 pt. 7,609
  7. Avatar for Jeuxdit<3 67. Jeuxdit<3 Lv 1 1 pt. 7,497
  8. Avatar for efull 68. efull Lv 1 1 pt. 7,449
  9. Avatar for jamiexq 69. jamiexq Lv 1 1 pt. 7,439
  10. Avatar for Trajan464 70. Trajan464 Lv 1 1 pt. 7,401

Comments