Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900
  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 53 pts. 10,408
  2. Avatar for Galaxie 12. Galaxie Lv 1 50 pts. 10,403
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 46 pts. 10,391
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 43 pts. 10,370
  5. Avatar for georg137 15. georg137 Lv 1 40 pts. 10,363
  6. Avatar for g_b 16. g_b Lv 1 37 pts. 10,323
  7. Avatar for Dr. Goochie 17. Dr. Goochie Lv 1 35 pts. 10,321
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 32 pts. 10,289
  9. Avatar for TheGUmmer 19. TheGUmmer Lv 1 30 pts. 10,251
  10. Avatar for Joanna_H 20. Joanna_H Lv 1 28 pts. 10,212

Comments