Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 26 pts. 10,167
  2. Avatar for Anfinsen_slept_here 22. Anfinsen_slept_here Lv 1 24 pts. 10,050
  3. Avatar for manu8170 23. manu8170 Lv 1 22 pts. 10,033
  4. Avatar for heather-1 24. heather-1 Lv 1 20 pts. 10,004
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 19 pts. 9,943
  6. Avatar for westchuck 26. westchuck Lv 1 17 pts. 9,923
  7. Avatar for Moolanie 27. Moolanie Lv 1 16 pts. 9,920
  8. Avatar for zxspectrum 28. zxspectrum Lv 1 14 pts. 9,892
  9. Avatar for Elfi 29. Elfi Lv 1 13 pts. 9,867
  10. Avatar for Apothecary1815 30. Apothecary1815 Lv 1 12 pts. 9,862

Comments