Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 6 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900

  1. Avatar for alcor29 31. alcor29 Lv 1 11 pts. 9,755
  2. Avatar for pfirth 32. pfirth Lv 1 10 pts. 9,717
  3. Avatar for equilibria 33. equilibria Lv 1 9 pts. 9,600
  4. Avatar for ucad 34. ucad Lv 1 8 pts. 9,575
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 8 pts. 9,520
  6. Avatar for jausmh 36. jausmh Lv 1 7 pts. 9,496
  7. Avatar for Hellcat6 37. Hellcat6 Lv 1 6 pts. 9,323
  8. Avatar for pizpot 38. pizpot Lv 1 6 pts. 9,167
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 5 pts. 9,162
  10. Avatar for SileNTViP 40. SileNTViP Lv 1 5 pts. 9,160

Comments