Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900
  1. Avatar for Mohoernchen 41. Mohoernchen Lv 1 4 pts. 9,130
  2. Avatar for drumpeter18yrs9yrs 42. drumpeter18yrs9yrs Lv 1 4 pts. 9,106
  3. Avatar for Dr.Sillem 43. Dr.Sillem Lv 1 3 pts. 9,084
  4. Avatar for jamestpierce 44. jamestpierce Lv 1 3 pts. 9,061
  5. Avatar for carxo 45. carxo Lv 1 3 pts. 8,923
  6. Avatar for Trajan464 46. Trajan464 Lv 1 3 pts. 8,898
  7. Avatar for zbp 47. zbp Lv 1 2 pts. 8,871
  8. Avatar for hada 48. hada Lv 1 2 pts. 8,806
  9. Avatar for ZiiONIC 49. ZiiONIC Lv 1 2 pts. 8,800
  10. Avatar for jamiexq 50. jamiexq Lv 1 2 pts. 8,753

Comments