Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 6 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900

  1. Avatar for Aarav_Awasthi 51. Aarav_Awasthi Lv 1 1 pt. 8,752
  2. Avatar for Fasodankfds 52. Fasodankfds Lv 1 1 pt. 8,579
  3. Avatar for Larini 53. Larini Lv 1 1 pt. 8,551
  4. Avatar for RWoodcock 54. RWoodcock Lv 1 1 pt. 8,534
  5. Avatar for Savas 55. Savas Lv 1 1 pt. 8,532
  6. Avatar for Penguiroth 56. Penguiroth Lv 1 1 pt. 8,498
  7. Avatar for athena99 57. athena99 Lv 1 1 pt. 8,489
  8. Avatar for mammillaria 58. mammillaria Lv 1 1 pt. 8,478
  9. Avatar for knowclue 59. knowclue Lv 1 1 pt. 8,459
  10. Avatar for Merf 60. Merf Lv 1 1 pt. 8,380

Comments