Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900
  1. Avatar for rinze 61. rinze Lv 1 1 pt. 8,323
  2. Avatar for majyunyan 62. majyunyan Lv 1 1 pt. 8,260
  3. Avatar for Alistair69 63. Alistair69 Lv 1 1 pt. 8,257
  4. Avatar for Steven Pletsch 64. Steven Pletsch Lv 1 1 pt. 8,247
  5. Avatar for efull 65. efull Lv 1 1 pt. 8,181
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 8,152
  7. Avatar for Jenot96 67. Jenot96 Lv 1 1 pt. 8,087
  8. Avatar for JanaAstrid_Plusulta 68. JanaAstrid_Plusulta Lv 1 1 pt. 8,045
  9. Avatar for Shadowmaster_ 69. Shadowmaster_ Lv 1 1 pt. 7,994
  10. Avatar for Jeshua Cuadros 70. Jeshua Cuadros Lv 1 1 pt. 7,951

Comments