Icon representing a puzzle

2680: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
October 29, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,532
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 7,919
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 7,900
  1. Avatar for JellyfishOliPlays 71. JellyfishOliPlays Lv 1 1 pt. 7,919
  2. Avatar for doctaven 72. doctaven Lv 1 1 pt. 7,900
  3. Avatar for Niorka 73. Niorka Lv 1 1 pt. 7,878
  4. Avatar for monitosexo 74. monitosexo Lv 1 1 pt. 7,870
  5. Avatar for berga 75. berga Lv 1 1 pt. 7,706
  6. Avatar for Maite 76. Maite Lv 1 1 pt. 7,674
  7. Avatar for ProfVince 77. ProfVince Lv 1 1 pt. 7,581
  8. Avatar for yianlee2008 78. yianlee2008 Lv 1 1 pt. 7,536
  9. Avatar for lordveznan 79. lordveznan Lv 1 1 pt. 6,830
  10. Avatar for ceoofchemistry 80. ceoofchemistry Lv 1 1 pt. 1,379

Comments