Placeholder image of a protein
Icon representing a puzzle

2687: Electron Density Reconstruction 144

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary

Created
November 05, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are four of the same protein chains in this model, but there's several segments missing on each. Even with those residues it's a very large puzzle and so the trim tool will be needed.

Sequence
MSDSKEVPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAALVEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFACNLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQEQARYRYCYAASPSLPVRTLRRGHGASEHEQLCMPVQESSDSPELLRTPVQESSSDSPEQTTLEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 79,631
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 68 pts. 79,580
  3. Avatar for Contenders 3. Contenders 44 pts. 79,552
  4. Avatar for Go Science 4. Go Science 27 pts. 78,985
  5. Avatar for VeFold 5. VeFold 16 pts. 78,535
  6. Avatar for Australia 6. Australia 9 pts. 76,469
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 76,462
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 75,193
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 73,334
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 68,937
  1. Avatar for christioanchauvin
    1. christioanchauvin Lv 1
    100 pts. 79,580
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 79,500
  3. Avatar for Galaxie 3. Galaxie Lv 1 86 pts. 79,171
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 79 pts. 79,082
  5. Avatar for Zhang Ruichong 5. Zhang Ruichong Lv 1 73 pts. 79,063
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 68 pts. 78,985
  7. Avatar for spvincent 7. spvincent Lv 1 62 pts. 78,887
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 57 pts. 78,535
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 52 pts. 78,445
  10. Avatar for grogar7 10. grogar7 Lv 1 48 pts. 78,040

Comments

LociOiling Lv 1

Nice small puzzle, 760 segments, consisting of four chains of 190 segments each.

It's a good match for PDB 2BBZ. The abstract reads:

The death-inducing signaling complex (DISC) comprising Fas, Fas-associated death domain (FADD), and caspase-8/10 is assembled via homotypic associations between death domains (DDs) of Fas and FADD and between death effector domains (DEDs) of FADD and caspase-8/10.

What fun!

Bletchley Park Lv 1

"The DISC has been implicated as a possible drug development target for various cancers, including leukemia, glioma, and colon cancer." So a worthwhile puzzle ! Thank you for looking it up !