Placeholder image of a protein
Icon representing a puzzle

2687: Electron Density Reconstruction 144

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary

Created
November 05, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are four of the same protein chains in this model, but there's several segments missing on each. Even with those residues it's a very large puzzle and so the trim tool will be needed.

Sequence
MSDSKEVPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAALVEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFACNLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQEQARYRYCYAASPSLPVRTLRRGHGASEHEQLCMPVQESSDSPELLRTPVQESSSDSPEQTTLEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 79,631
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 68 pts. 79,580
  3. Avatar for Contenders 3. Contenders 44 pts. 79,552
  4. Avatar for Go Science 4. Go Science 27 pts. 78,985
  5. Avatar for VeFold 5. VeFold 16 pts. 78,535
  6. Avatar for Australia 6. Australia 9 pts. 76,469
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 76,462
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 75,193
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 73,334
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 68,937
  1. Avatar for westchuck 21. westchuck Lv 1 16 pts. 76,391
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 15 pts. 76,171
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 13 pts. 76,040
  4. Avatar for Xendrais 24. Xendrais Lv 1 12 pts. 75,808
  5. Avatar for georg137 25. georg137 Lv 1 10 pts. 75,621
  6. Avatar for silent gene 26. silent gene Lv 1 9 pts. 75,449
  7. Avatar for ichwilldiesennamen 27. ichwilldiesennamen Lv 1 8 pts. 75,342
  8. Avatar for alcor29 28. alcor29 Lv 1 7 pts. 75,217
  9. Avatar for jausmh 29. jausmh Lv 1 6 pts. 75,193
  10. Avatar for Elfi 30. Elfi Lv 1 6 pts. 74,857

Comments

LociOiling Lv 1

Nice small puzzle, 760 segments, consisting of four chains of 190 segments each.

It's a good match for PDB 2BBZ. The abstract reads:

The death-inducing signaling complex (DISC) comprising Fas, Fas-associated death domain (FADD), and caspase-8/10 is assembled via homotypic associations between death domains (DDs) of Fas and FADD and between death effector domains (DEDs) of FADD and caspase-8/10.

What fun!

Bletchley Park Lv 1

"The DISC has been implicated as a possible drug development target for various cancers, including leukemia, glioma, and colon cancer." So a worthwhile puzzle ! Thank you for looking it up !