Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,384
  2. Avatar for Team China 12. Team China 1 pt. 9,054
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,527
  4. Avatar for Bioqué? 14. Bioqué? 1 pt. 8,513
  1. Avatar for bravosk8erboy 11. bravosk8erboy Lv 1 48 pts. 10,074
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 45 pts. 10,058
  3. Avatar for Aarav_Awasthi 13. Aarav_Awasthi Lv 1 41 pts. 10,055
  4. Avatar for g_b 14. g_b Lv 1 38 pts. 10,049
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 35 pts. 10,016
  6. Avatar for Dr. Goochie 16. Dr. Goochie Lv 1 32 pts. 10,001
  7. Avatar for zxspectrum 17. zxspectrum Lv 1 30 pts. 9,999
  8. Avatar for georg137 18. georg137 Lv 1 27 pts. 9,953
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 25 pts. 9,946
  10. Avatar for akaaka 20. akaaka Lv 1 23 pts. 9,946

Comments