Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,384
  2. Avatar for Team China 12. Team China 1 pt. 9,054
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,527
  4. Avatar for Bioqué? 14. Bioqué? 1 pt. 8,513
  1. Avatar for BarrySampson 21. BarrySampson Lv 1 21 pts. 9,920
  2. Avatar for Elfi 22. Elfi Lv 1 19 pts. 9,895
  3. Avatar for jausmh 23. jausmh Lv 1 17 pts. 9,893
  4. Avatar for AlkiP0Ps 24. AlkiP0Ps Lv 1 16 pts. 9,889
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 14 pts. 9,882
  6. Avatar for grogar7 26. grogar7 Lv 1 13 pts. 9,865
  7. Avatar for silent gene 27. silent gene Lv 1 12 pts. 9,837
  8. Avatar for WBarme1234 28. WBarme1234 Lv 1 10 pts. 9,815
  9. Avatar for Dr.Sillem 29. Dr.Sillem Lv 1 9 pts. 9,762
  10. Avatar for Joanna_H 30. Joanna_H Lv 1 8 pts. 9,752

Comments