Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,384
  2. Avatar for Team China 12. Team China 1 pt. 9,054
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,527
  4. Avatar for Bioqué? 14. Bioqué? 1 pt. 8,513
  1. Avatar for ZiiONIC 51. ZiiONIC Lv 1 1 pt. 9,266
  2. Avatar for majyunyan 52. majyunyan Lv 1 1 pt. 9,221
  3. Avatar for rinze 53. rinze Lv 1 1 pt. 9,105
  4. Avatar for zo3xiaJonWeinberg 54. zo3xiaJonWeinberg Lv 1 1 pt. 9,054
  5. Avatar for sdjf 55. sdjf Lv 1 1 pt. 9,040
  6. Avatar for Greg60 56. Greg60 Lv 1 1 pt. 8,979
  7. Avatar for akonin28 57. akonin28 Lv 1 1 pt. 8,960
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 8,930
  9. Avatar for Merf 59. Merf Lv 1 1 pt. 8,730
  10. Avatar for tamai 60. tamai Lv 1 1 pt. 8,663

Comments